• Buy cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate product
    ... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate... more
    Brand Name:YIHAN
    Model Number:Sermorelin
    Place of Origin:hina

    Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Buy cheap Muscle Bodybuilding Sermorelin Acetate 2mg Repair Of Injury product
    ...Repair of Injury Sermorelin Acetate 2mg for Muscle Bodybuilding Detailed information: Sermorelin acetate is a synthetic analog of naturally occurring Growth Hormone-Releasing Hormone (GHRH). GHRH is produced in ... more
    Brand Name:Bodybiolgical
    Model Number:Sermorelin
    Place of Origin:Hubei, China

    Muscle Bodybuilding Sermorelin Acetate 2mg Repair Of Injury

  • Buy cheap High Purity Muscle Growth Peptides , Sermorelin Acetate Bodybuilding GRF 1-29 product
    ...Sermorelin Acetate Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) Product Name Sermorelin Acetate Also known as Sermorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type ... more
    Brand Name:Hongxi Pharm
    Model Number:SARMs Powder
    Place of Origin:HongKong/China

    High Purity Muscle Growth Peptides , Sermorelin Acetate Bodybuilding GRF 1-29

  • Buy cheap Sermorelin Acetate Muscle Building Peptides CAS 86168-78-7 With 99% Purity product
    ...What is Sermorelin? Also called as GRF 1-29, Sermorelin is GHRH derivative that contains first, active 29 amino acids chain of GHRH that promote release of growth hormones from the pituitary. Sermorelin forms... more
    Brand Name:TINGYI
    Model Number:CAS: 86168-78-7
    Place of Origin:CHINA

    Sermorelin Acetate Muscle Building Peptides CAS 86168-78-7 With 99% Purity

  • Buy cheap Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle product
    ... Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance... more
    Brand Name:Saichuang
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle

  • Buy cheap Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep product
    ...Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ... more
    Brand Name:Yihan
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  • Buy cheap Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 product
    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-... more
    Brand Name:BestSteroid
    Model Number:2mg
    Place of Origin:Hubei,China

    Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

  • Buy cheap Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder product
    ...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu... more
    Brand Name:Top Pharm
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder

  • Buy cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH product
    ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first... more
    Brand Name:KANGDISEN
    Model Number:2 mg/vial
    Place of Origin:China

    Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH

  • Buy cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder product
    ...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ... more
    Brand Name:Muscle Man
    Model Number:400
    Place of Origin:Hunan,China

    2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder

  • Buy cheap Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss product
    ...Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss​ Product Name: Sermorelin Acetate Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Brand Name:Sermorelin Acetate
    Model Number:86168-78-7
    Place of Origin:SHANGHAI

    Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss

  • Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product
    ... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe... more
    Categories:API(Active Pharmaceutical Ingredients)
    Country/Region:china

    Sermorelin Acetate 99.0% bulk powder cas 86168-78-7

  • Buy cheap Sermorelin Acetate Powder product
    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human... more
    Place of Origin:China
    Delivery Time:3 days
    Payment Terms:WU, t/t

    Sermorelin Acetate Powder

  • Buy cheap Sermorelin Acetate product
    ...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Brand Name:YC
    Place of Origin:wuhan china
    Certification:ISO9001

    Sermorelin Acetate

  • Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product
    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... more
    Brand Name:Youngshe
    Model Number:YSPI
    Place of Origin:Chengdu , China

    Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee

  • Buy cheap Sermorelin Acetate product
    Sermorelin Acetate Cas no: 86168-78-7 Sermorelin is used in the treatment of prevention of HIV-induced weight loss, children with growth hormone deficiency or growth failure. more
    Place of Origin:China
    Minimum Order Quantity:10
    Payment Terms:Moneygram,Bank Transfer

    Sermorelin Acetate

  • Buy cheap Bodybuilding supplements peptide Sermorelin acetate 86168-78-7 Factory price fast shipping product
    ...Bodybuilding supplements Sermorelin acetate 86168-78-7 Factory price fast shipping Base information of Sermorelin acetate Chemical Name: Sermorelin acetate CAS No : 86168-78-7 Sequence :H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-... more
    Place of Origin:China
    Minimum Order Quantity:2 Grams
    Payment Terms:T/T, Western Union, MoneyGram

    Bodybuilding supplements peptide Sermorelin acetate 86168-78-7 Factory price fast shipping

  • Buy cheap GRF 1-29 NH2, Sermorelin Acetate Hydrate / skype:sucy1171 product
    Contact :Sucy Skype:sucy1171 E -mail:sucy@ycphar.com Whatsapp:+8618872220809 http://www.servechemical.com 1.Quick Details: Usage: Our advantage: Related Products: more
    Brand Name:YC-WUMEI
    Model Number:WUMEI
    Place of Origin:Made in China

    GRF 1-29 NH2, Sermorelin Acetate Hydrate / skype:sucy1171

Tell “sermorelin acetate side effects” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0