• Buy cheap LGRF 1-29 Sermorelin Acetate Peptides For Building Muscle CAS 86168-78-7 product
    ... first 29 amino acids is actually what is responsible for stimulating pituitary response. The name Sermorelin is the prescription drug name and this alone is why it is so widely prescribed... more
    Brand Name:Saichuang
    Model Number:86168-78-7
    Place of Origin:Wuhan,Hubei

    LGRF 1-29 Sermorelin Acetate Peptides For Building Muscle CAS 86168-78-7

  • Buy cheap Sermorelin Acetate Human Growth Hormone Anti Aging CAS 86168-78-7 For Adults product
    ...Sermorelin Acetate Growth Human Peptides for Anti Aging CAS 86168-78-7 Product Name Sermorelin Acetate CAS No. 86168-78-7 Synonyms Sermorelina; Sermorelinum; Sermoreline Molecular Formula C149H246N44O42S Molecular Weight 3357.882 g·mol−1 Structure ... more
    Brand Name:ORIPHARM
    Model Number:XALY
    Place of Origin:China

    Sermorelin Acetate Human Growth Hormone Anti Aging CAS 86168-78-7 For Adults

  • Buy cheap LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 product
    ...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also... more
    Brand Name:YUANHANG
    Model Number:86168-78-7
    Place of Origin:CHINA

    LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7

  • Buy cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate product
    ... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate... more
    Brand Name:YIHAN
    Model Number:Sermorelin
    Place of Origin:hina

    Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Buy cheap 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning product
    ...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ... more
    Brand Name:HongKong Blue
    Model Number:CAS No.: 86168-78-7
    Place of Origin:CHINA

    99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning

  • Buy cheap Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder product
    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ... more
    Brand Name:Sermorelin
    Model Number:87616-84-0
    Place of Origin:china

    Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Buy cheap Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed product
    ... Step Guide For Making Tren Ace 100 Oil. The recipe for 1000 ml of trenbolone acetate @ 100 mg/ml we use: powders: 100 grams; BA: 2%, 20 ML BB: 10%, 100 ML... more
    Brand Name:TINGYI
    Model Number:10161-34-9
    Place of Origin:China

    Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed

  • Buy cheap Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available product
    ...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ... more
    Brand Name:HBYC
    Model Number:HBYC
    Place of Origin:China

    Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available

  • Buy cheap Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality product
    ...Bodybuilding Peptides Sermorelin Acetate 2mg/vial Human Growth Hormones For Fat Loss Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ... more
    Brand Name:Yihan
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  • Buy cheap Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder product
    ...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu... more
    Brand Name:Top Pharm
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder

  • Buy cheap 302.41 MW Most Effective Prohormone , Synthetic Steroid Hormones 7 - Keto - DHEA product
    Prohormones Steroid Hormones Powder 7-Keto-Dehydroepiandrosterone 7-Keto-DHEA for Muscle Building 566-19-8 COA: Product Name 7-Keto-DHEA Batch NO. 20150508 Test Date 2015.05.08 Quantity 15kg Expiry Date 2017.05.07 Manufacturing 2015.05.08 Test ... more
    Brand Name:HW Steroid Hormones Powder
    Model Number:Pharmaceutical Grade Steroid Hormones Powder
    Place of Origin:China

    302.41 MW Most Effective Prohormone , Synthetic Steroid Hormones 7 - Keto - DHEA

  • Buy cheap Sermorelin CAS 86168-78-7 Muscle Building Sterods Growth Hormone Releasing Hormones product
    ... Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate Product Name: Sermorelin Unit size: 2 mg/vial CAS NO.: 86168-78-7 Synonyms: GRF 1-29 Sequence... more
    Brand Name:Keray
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin CAS 86168-78-7 Muscle Building Sterods Growth Hormone Releasing Hormones

  • Buy cheap Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building product
    ...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ... more
    Brand Name:SD
    Model Number:99%
    Place of Origin:shenzhen,china

    Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building

  • Buy cheap Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial product
    ... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate... more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Injectable Growth Hormone Muscle Buildig Peptides Sermorelin Acetate 2mg/vial

  • Buy cheap Sermorelin Acetate Powder product
    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human... more
    Place of Origin:China
    Delivery Time:3 days
    Payment Terms:WU, t/t

    Sermorelin Acetate Powder

  • Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product
    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... more
    Brand Name:Youngshe
    Model Number:YSPI
    Place of Origin:Chengdu , China

    Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee

  • Buy cheap Sermorelin Acetate product
    ...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Brand Name:YC
    Place of Origin:wuhan china
    Certification:ISO9001

    Sermorelin Acetate

  • Buy cheap High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 product
    ...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree... more
    Brand Name:JNJG
    Model Number:86168-78-7
    Place of Origin:CHINA

    High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7

  • Buy cheap Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide product
    ...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Place of Origin:China
    Minimum Order Quantity:10vials
    Price:nigotiate

    Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide

  • Buy cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH product
    ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first... more
    Brand Name:KANGDISEN
    Model Number:2 mg/vial
    Place of Origin:China

    Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH

Tell “sermorelin acetate side effects” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0