• Buy cheap CAS 86168-78-7 10mg HGH Anabolic Steroids Muscle Growth PT-141 Sermorelin Acetate product
    ...Chinese Peptide Powder PT141 for Sexual Dysfunction Lab Supply Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Brand Name:Filter
    Model Number:API
    Place of Origin:China

    CAS 86168-78-7 10mg HGH Anabolic Steroids Muscle Growth PT-141 Sermorelin Acetate

  • Buy cheap Triptorellin Acetate Pharmaceutical Peptides Medicial Grade 2mg / Vial Synthetic product
    ... potency than endogenous LHRH, triptorelin reversibly represses gonadotropin secretion. After chronic, continuous administration, this agent effects sustained decreases in LH and FSH production and testicular and ovarian steroidogen more
    Brand Name:FILTER
    Model Number:12629-01-5
    Place of Origin:Shanghai

    Triptorellin Acetate Pharmaceutical Peptides Medicial Grade 2mg / Vial Synthetic

  • Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product
    ... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe... more
    Categories:API(Active Pharmaceutical Ingredients)
    Country/Region:china

    Sermorelin Acetate 99.0% bulk powder cas 86168-78-7

  • Buy cheap Sermorelin Acetate Powder product
    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human... more
    Place of Origin:China
    Delivery Time:3 days
    Payment Terms:WU, t/t

    Sermorelin Acetate Powder

  • Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product
    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... more
    Brand Name:Youngshe
    Model Number:YSPI
    Place of Origin:Chengdu , China

    Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee

  • Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product
    ... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe... more
    Categories:API(Active Pharmaceutical Ingredients)
    Telephone:86-755-26879710
    Country/Region:china

    Sermorelin Acetate 99.0% bulk powder cas 86168-78-7

  • Buy cheap Sermorelin Acetate product
    ...Sermorelin Acetate CAS : 86168-78-7 MF : C149H246N44O42S Spec : USP28/BP2003 Color : White Crystalline Powder Brand : YC Detail Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys... more
    Categories:Peptide CJC 1295
    Telephone:86-027-50755978
    Country/Region:china

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Products HOME > Products >Sermorelin Acetate Sermorelin Acetate CAS Number:114466-38-5 Name:1-29-Somatoliberin(human pancreatic islet), 29-L-argininamide-, acetate (salt), hydrate (9CI) Superlist Name:Sermorelin acetate Formula:C149H246N44O42S.C2H4O2 ... more
    Categories:Food Grade Acetic Acid
    Telephone:+86-(0)571-87207232 +86-(0)571-87207239 +86-(0)571-87207315 +86-(0)571-81061160
    Country/Region:china

    Sermorelin Acetate

  • Buy cheap Peptide APIs Sermorelin Acetate product
    Products: Sermorelin Acetate Cas No.: 86168-78-7 Molecular Structure: Sermorelin Acetate Cas No86168-78-7 more
    Categories:Other APIS
    Telephone:027-81302488
    Country/Region:china

    Peptide APIs Sermorelin Acetate

  • Buy cheap Peptide Sermorelin Acetate product
    ...Sermorelin Acetate CAS No.: English name:Sermorelin Acetate Chinese name: Purity Molecular formulaC149H246N44O42S Molecular weight3357.88 CAS No:86168-78-7 Series No.:H-Tyr-... more
    Categories:Ipamorelin Peptide
    Country/Region:china

    Peptide Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Octreotide Acetate Sermorelin Acetate Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Place of Origin:chengdu,china
    Category:Cardiovascular Agents
    Sample Price:None Specified

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Product Description Sermorelin AcetateProduct Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Place of Origin:china
    Sample Price:negotiable
    Category:Cardiovascular Agents

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Sermorelin Acetate 2mg/vial Molecular Formula:C149H246N44O42 Molecular Weight:3358.03 CAS No.:86168-78-7 Sequence: SPECIFICATIONS: 1.... more
    Model Number:CAS No.:86168-78-7
    Place of Origin:China
    Category:Vitamins, Amino Acids and Coenzymes

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Detailed Product Description Sermorelin Acetate Molecular Formula:C149H246N44O42 Molecular Weight:3358.03 CAS No.:86168-78-7 Sequence:Tyr-Ala-Asp-... more
    Place of Origin:china
    Sample Price:negotiable
    Category:Vitamins, Amino Acids and Coenzymes

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...Sermelin Acetate Name:Sermelin Acetate MW :3358.03 Type:GMP peptides Formula :C149H246N44O42S Sequence:Tyr-Ala-Asp-Ala-Lle-Phe-... more
    Brand Name:GLS
    Place of Origin:China

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4.Acetate Content(by HPLC) :≤15.0% 5.Amino Acid Composition :±10% of theoretical 6.Purity(by HPLC) :≥98.0% 7.Single... more
    Model Number:Cas NO:86168-78-7
    Place of Origin:china
    Category:Vitamins, Amino Acids and Coenzymes

    Sermorelin Acetate

  • Buy cheap Sermorelin Acetate product
    ...SPECIFICATIONS: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4.Acetate Content(by HPLC) :≤15.0% 5.Amino Acid Composition :±10% of theoretical 6.Purity(by HPLC) :≥98.0% 7.... more
    Place of Origin:china
    Category:Vitamins, Amino Acids and Coenzymes
    Sample Price:Depending on exchange rate fluctuations

    Sermorelin Acetate

  • Buy cheap GHRP-2 Acetate,GHRP-6 Acetate,CJC1295,Sermorelin Acetate, product
    Packing: plastic vial(dedicated for peptide packing) or glass vial, quantity according to customer's detail requirement. Storage:a cool(2~8 ℃) & dry place protected from light, keep package close when not in use. more
    Place of Origin:China
    Purity:99%
    Sample Price:Depending on the customs tariff

    GHRP-2 Acetate,GHRP-6 Acetate,CJC1295,Sermorelin Acetate,

  • Buy cheap Sermorelin GRF(1-29) 86168-78-7(net),114466-38-5(acetate) product
    ... known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French]. Please contact us for more details about Sermorelin Acetate. Sales Manager Ying Lee more
    Brand Name:YS
    Model Number:YSAP
    Place of Origin:China

    Sermorelin GRF(1-29) 86168-78-7(net),114466-38-5(acetate)

  • Buy cheap high qualitySteroids .bodybuilding productsSteroi .r.No Side Effect Sex Enhancers Tadalafil with Best Effectiveness dicr product
    ...No Side Effect Sex Enhancers Tadalafil with Best Effectiveness high quality .bodybuilding products .steroids powder. Model NO.: 171596-29-5 Tadalafil Other Name: Tadalafil CAS: ... more
    Brand Name:nanjian
    Model Number:Pharmaceutical intermediates
    Place of Origin:china

    high qualitySteroids .bodybuilding productsSteroi .r.No Side Effect Sex Enhancers Tadalafil with Best Effectiveness dicr

Tell “sermorelin acetate side effects” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0