• Buy cheap Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial product
    Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial Cas No:62031-54-3 Unit Size :2 mg/vial HPLC purity:98% SDS-PAGE purity:98%. Synonyms: MGF, Mechano Growth Factor, IGF-1Ec Molecular Formula : C121H200N42O39 Molecular Weight :2948.15 Sequence :PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-D-Arg-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 Appearance :White Powder Source :Chemical Synthesis Storage :Lyophilized Peg MGF is stable at room temperature for 90 days... more
    Brand Name:HKB
    Model Number:62031-54-3
    Place of Origin:China

    Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial

  • Buy cheap 98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding product
    98% AICAR Raw Peptide AICAR CAS2627-69-2 Powder for Body-building CAS:2627-69-2 Purity:98% Appearance:white powder M.W.:258.231 M.F.:C9H14N4O5 Packing:10g/foil bag AICAR Storage: Before reconstitution (lyophilized / freeze dried powder): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 36 months. Can be stored at room Temperature (up to 37°C = 99°F) for 90 days. After reconstitution (liquid): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 5 days. AIRCAR, also more
    Brand Name:Yuancheng
    Model Number:2627-69-2
    Place of Origin:Wuhan,Hubei

    98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding

  • Buy cheap CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding product
    Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular Formula C152H252N44O42 One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Physical Apperance white powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as ... more
    Brand Name:BestSteroid
    Model Number:863288-34-0
    Place of Origin:Hubei,China

    CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

  • Buy cheap Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding product
    Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 CAS Number 80449-31-6 Molecular Formula C13H16O3 Molecular Weight 751.9 N-terminal Sequence Gly30 specification 1mg/vail / 2mg/vail Assay 99.5% Appearance White powder Follistatin-344 Description Additional scientific study that has been conducted on animal test subjects has also determined that Follistatin 344 acts as an antagonist to myostatin; more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding

  • Buy cheap 98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial product
    98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial Pegylated Mechano Grow Factor Peptides Hormones Pegylated MGF PEG MGF Pegylated Mechano Grow Factor Peptides Hormones Product name PEG MGF Other name Pegylated Mechano Grow Factor, Pegylated MGF CAS number N/A sjgbolic Molecular formula C121H200N42O39 Molecular weight 2867.2 Assay( Puriy) Above 98% Usage PEG MGF(Pegylated Mechano Grow Factor) As Peptides Hormones Promote your body releases a pulse of an MGF splice ... more
    Brand Name:YIHAN
    Model Number:PEG-MGF
    Place of Origin:China

    98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial

  • Buy cheap Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF product
    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 2 . Description PEGylation is the act of attaching a Polyethylene glycol (PEG) structure to another larger molecule (in this case, MGF). The PEG acts as a protective coating and the theory here is . more
    Brand Name:kafen
    Model Number:HGH-Eptifibatide
    Place of Origin:Guangzhou,China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF

  • Buy cheap CAS 170851-70-4  Peptides Powder Bodybuilding  CJC-1295 With DAC ISO9001 Standard product
    CAS 170851-70-4 Injectable Peptides Bodybuilding Pharmaceutical CJC-1295 With DAC CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.853 Assay: 99% Peptide Hormone 2mg/vial CJC-1295 with DAC Bodybuilding Supplements Quality testing: All the steroids only be shipped out before tested in university and lab here. Use Guidance: CJC-1295 is most suited to instances where an individual wishes to inject infrequently and is seeking substantive support for GH production rather than a maximum or near-maximum ... more
    Brand Name:Yuancheng
    Model Number:170851-70-4
    Place of Origin:China

    CAS 170851-70-4 Peptides Powder Bodybuilding CJC-1295 With DAC ISO9001 Standard

  • Buy cheap Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment product
    Melanotan II CAS 121062-08-6 Injectable Peptides Bodybuilding For Sexual Dysfunction Treatment Quick Details: * Product name: Melanotan-II/ MT-2* Synonyms: melanotan; Melanotan-II; MT-II* CAS No.: 121062-08-6* Grade: Pharmaceutical Grade * Molecular Formula: C50H71N15O10* Molecular Weight: 1042.1932* Assay: 99%* Packing: 2mg/vial, quantity according to customer\'s detail requirements.* Melting point: 2℃* Boiling point: 225℃* Appearance: White crystalline powder. * Storage: Closed, below 2 ~ 8℃ . more
    Brand Name:YC
    Model Number:CAS NO.: 121062-08-6
    Place of Origin:China

    Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment

  • Buy cheap MT-1 Injectable HGH Peptides Bodybuilding   75921-69-6 Melanotan I product
    MT-1 Injectable HGH Peptides Bodybuilding 75921-69-6 Melanotan I MT-1 White Lyophilized Melanotan muscle gain steroids Peptide Powder MT 1 MT-1 White Lyophilized Peptide Hormone Powder Melanotan I Melanotan I Melanotan II GHRP-2 GHRP-6 CJC1295 DAC-CJC1295 MGF PEG-MGF fragment177-191 fragment 176-191AOD PT141 Sermorelin Hexarelin Ipamorelin EGF MT-1 Basic Info. MT 1 Model No.: Melanotan I 10mg/vial, 100vial/kit Melanotan Export Markets: Global Melanotan I Product Description Melanotan I : 75921.. more
    Brand Name:Steroid(Saichuang)
    Model Number:99
    Place of Origin:China

    MT-1 Injectable HGH Peptides Bodybuilding 75921-69-6 Melanotan I

  • Buy cheap High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 product
    High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1.333g/cm3 Boiling Point: 1407°C at 760 mmHg Storage Temperature: 20°C Refractive index: 1.664 Purity (HPLC): 98.0%min. Appearance: White powder Single Impurity (HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content (N%): ≥80.0% Water Content(Karl Fischer): ≤6.0% Acetate Content (HPIC): ≤12.0% Description: .. more
    Brand Name:YUANYANG
    Model Number:CAS: 158861-67-7
    Place of Origin:CHINA

    High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7

  • Buy cheap Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 product
    Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% of theoretical Peptide Content(N%): 80%(by %N) Water Content(Karl Fischer): 6.0% Acetate Content(HPIC): 15.0% MS(ESI): N/A Mass Balance: 95.0~105.0% Payment & Shipping Terms: Mini Order: 10 vials Price: Negotiable Packaging Details: Super discreet to ensure more
    Brand Name:Shuangbojie
    Model Number:863288-34-0
    Place of Origin:China

    Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0

  • Buy cheap PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor product
    PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor​ Basic View: 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 Brief Introduction: 1. PEG-MGF, or PEGylated Mechano Growth Factor is a new and innovative form of MGF that outperforms natural MGF many times over. MGF is a splice variant of the IGF gene which increases stem cell more
    Brand Name:BOF
    Model Number:N/A
    Place of Origin:China

    PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor

  • Buy cheap Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids product
    Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids What Does BPC-157 Do? BPC-157 surprisingly has no side effects, and it has been shown in a study to restore tendons, muscles, intestines, teeth, bones, etc. In in vivo studies for humans and rodents, as well as with oral or injectable subcutaneous or intramuscular injection . BPC-157 Was Shown 1, Stimulate the tendon and ligament healing as a result of the growth of tendons, cell survival and cell migration in the model of .. more
    Brand Name:Shanghai Stero
    Model Number:BPC-157
    Place of Origin:China

    Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids

  • Buy cheap Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building product
    Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other Name: Ghrp-6 Acetate Function: for Weight Loss Storage: Keep Cold Form: White Frozen Dry Powder Type: Raw Material Transport Package: Vial Origin: Shanghai,China Powder: Yes Certification: GMP, SGS, ISO 9001, USP, BP Discount:Available For Big Quantity Product Name: Ghrp-6 CAS: 87616-84-0 Place of Origin: Shanghai Shelf Life: 2 Years .. more
    Brand Name:Gear Steroids
    Model Number:87616-84-0
    Place of Origin:CHINA

    Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building

  • Buy cheap Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder product
    Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank Molecular Weight 751.9 Selank specification: 2mg/vail / 10mg/vail Selank Assay : 99.5% Selank Appearance : White powder Selank Description Selank is a nootropic, anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Selank is a heptapeptide with the . more
    Brand Name:purity
    Model Number:129954-34-3
    Place of Origin:china

    Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder

  • Buy cheap Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4 product
    95% IGF-1 LR3 1mg Growth Hormone Peptides 946870-92-4 LR3 IGF1 Human 1, IGF-1 LR3 (1mg) Introduction: Product name: IGF-1 LR3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1, LR3 IGF1 Human IGF-1 LR3 Specification: 1mg per vial IGF-1 LR3 CAS#: 946870-92-4 IGF-1 LR3 Physical Appearance: Sterile Filtered White Lyophilized (freeze-dried) Powder IGF-1 LR3 Source: Escherichia Coli IGF-1 LR3 Purity: Greater than 90.0% as ... more
    Brand Name:Blue Dragon
    Model Number:IGF-1 LR3 (1mg)
    Place of Origin:China Manufacturer

    Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4

  • Buy cheap Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder product
    Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides Bodybuilding Product Details: Product Name Gonadorelin Acetate Also known as Gonadorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type Injection Supplying Form Lyophilized Powder In Vials / Pure Raw Powder No Vial Custom Supported. ①. Various Colors of Flip off Caps ②. 2mg/vial , 5mg/vial, 10mg/vial , or no vials . ③. Peptides Blend According to Your Demand. such as CJC more
    Brand Name:Yvonne
    Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial
    Place of Origin:China

    Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder

  • Buy cheap Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth product
    Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth 1. Drostanolone Enanthate Alias: Drostanolone; Drolban; Masteron-E, Masteron Enanthate CAS NO.: 472-61-145 Molecular formula: C27H44O3 Molecular weight: 416.64 Characters: White powder . Melting point: 65℃—68℃ Half life: 8-10 days Detection time: 3months 2. Description Masteron Enanthate is the anabolic steroid that is slow acting, but is acts for longer period of time. In fact, Masteron more
    Brand Name:LANDMARK
    Model Number:HPLC verfied
    Place of Origin:CHINA

    Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth

  • Buy cheap Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates product
    Growth Hormone Peptides GHRP-6 CAS 87616-84-0 For Muscle Increasement Quick Details: Product Name:GHRP-6 (Growth Hormone Releasing Peptide 6) CAS: 87616-84-0 MF: C46H56N12O6 MW: 873.01 Purity (HPLC): 98.0%min. Appearance: White powder Usage: Pharmaceutical intermediates. COA: Product Name GHRP-2 Acetate Sequence Cas No. 158861-67-7 Molecular Formula C45H55N9O6 Molecular Weight 818.0 Purity (HPLC) 98.0%min. Appearance White powder Single Impurity (HPLC) 1.0%max Amino Acid Composition ±10% of ... more
    Brand Name:DW
    Model Number:87616-84-0
    Place of Origin:China

    Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates

  • Buy cheap Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding product
    ...Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 ... more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding

  • Buy cheap Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building product
    ...Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other ... more
    Brand Name:Gear Steroids
    Model Number:87616-84-0
    Place of Origin:CHINA

    Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building

  • Buy cheap High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 product
    ...High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Muscle building Steroids Product Name:2, 4-Dinitrophenol Alias: DNP DNP ... more
    Brand Name:Biofriend
    Model Number:51 - 28 - 5
    Place of Origin:China

    High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5

  • Buy cheap High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 product
    ...DNP 2, 4-Dinitrophenol Bodybuilding Prohormones CAS 51-28-5 For Fat Burning Product Name:2, 4-Dinitrophenol Alias: DNP DNP CAS No: ... more
    Brand Name:Muscle Bodybuilding
    Model Number:CAS 51-28-5
    Place of Origin:China

    High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5

  • Buy cheap Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF product
    ...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular ... more
    Brand Name:kafen
    Model Number:HGH-Eptifibatide
    Place of Origin:Guangzhou,China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF

  • Buy cheap Injectable Peptides Bodybuilding CJC-1295 With DAC 2mg/Vial For Increase GH product
    ...Injectable peptides Steroids CJC1295 / CJC-1295 with DAC 2mg/vial for Increase GH with Colorful Tops CJC-... more
    Brand Name:anabolic-oral steroids
    Model Number:CJC1295
    Place of Origin:China

    Injectable Peptides Bodybuilding CJC-1295 With DAC 2mg/Vial For Increase GH

    JCJ Logis Co.,ltd
    [Hubei,China]
  • Buy cheap High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 product
    ...High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1.... more
    Brand Name:YUANYANG
    Model Number:CAS: 158861-67-7
    Place of Origin:CHINA

    High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7

  • Buy cheap Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding product
    ...99% Purity China lab Bodybuilding Peptide Tesamorelin Product Description Tesamorelin, 2mg/vial Sequence: C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-... more
    Brand Name:nanjian
    Model Number:2mg/Vial
    Place of Origin:China

    Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding

  • Buy cheap Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement product
    ...TB500 Peptide Bodybuilding TB -4 Fragment Thymosin Beta 4 Performance Enhancement Basic Info. Product Name TB-500 Also known as ... more
    Brand Name:LSW
    Model Number:TB500 Lyophilized Powder In Vials / Pure Raw Powder No Vial
    Place of Origin:China TB500

    Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement

  • Buy cheap Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Without Negative Side Effects170851-70-4 product
    ...Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:hongkong ... more
    Brand Name:wumeitech
    Model Number:CAS 77591-33-4 Pure Lab Peptides Thymosin Beta 4 /Tb500/Tb-500 Basic Info Port:China Production Capacity:50000pieces/Year Payment Terms: T/T,Western Union, Money Gram Model NO.: 77591-33-4 Customized: Customized Suitable for: Adult Purity: >97% Appearanc
    Place of Origin:China

    Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Without Negative Side Effects170851-70-4

  • Buy cheap HMG Human Menopausal Gonadotropin 75iu 99% Purity Injectable Peptides product
    ...Human Menopausal Gonadotropin HMG 75iu 99% purity Human Menopausal Gonadotropin, known as HMG, is an injectable peptide. Initially, HMG was invented in order to help women conceive. It is a fertility medication which... more
    Brand Name:Landmark
    Model Number:Pharma Grade
    Place of Origin:China

    HMG Human Menopausal Gonadotropin 75iu 99% Purity Injectable Peptides

  • Buy cheap Human Growth Peptides Bodybuilding Powder Hexarelin 140703-51-1 Suggestion Administration product
    ...Growth Peptides Bodybuilding Powder Hexarelin 140703-51-1 Suggestion Administration Do you have any discounts if I place an order ? ... more
    Brand Name:Keray
    Model Number:SHSC-02514
    Place of Origin:China

    Human Growth Peptides Bodybuilding Powder Hexarelin 140703-51-1 Suggestion Administration

  • Buy cheap Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 product
    ...Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 Just try a small order to start our cooperation, we will NOT make ... more
    Brand Name:HKYC
    Model Number:muscle building
    Place of Origin:HUBEI,CHINA

    Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0

  • Buy cheap Injectable Raw white Peptides Bodybuilding Ipamorelin 170851-70-4 For Muscle Enhancement product
    ... (HPLC): 98.0% Appearance: White powder Single Impurity (HPLC): 0.5%max Amino Acid Composition: ±10% of theoretical Peptide Content(N%): ≥80.0% Water Content(Karl Fischer): ≤8.0% Acetate Content(HPIC): ≤10.0% Specific Rotation (20/D): -55.0~-65... more
    Brand Name:Yuancheng
    Model Number:170851-70-4
    Place of Origin:Wuhan,Hubei

    Injectable Raw white Peptides Bodybuilding Ipamorelin 170851-70-4 For Muscle Enhancement

  • Buy cheap Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding product
    ...Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding Quick Details : CAS 218949-48-5 SYNONYMS Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-... more
    Brand Name:Pharmlab
    Model Number:218949-48-5
    Place of Origin:China

    Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Buy cheap Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding product
    ... powder Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human... more
    Brand Name:ChineseHormone
    Model Number:CAS:86168-78-7
    Place of Origin:China

    Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding

  • Buy cheap Healthy Peptides Bodybuilding Hormone Delta Sleep-inducing Peptide DSIP 2mg/vial product
    ...#: 62568-57-4 Formula: C35H48N10O15 Molecular Weight: 848.81 Purity: 99.0%min 2. Description: Delta sleep-inducing peptide, abbreviated DSIP, is a neuropeptide that when infused into the mesodiencephalic ventricle of recipient rabbits induces... more
    Brand Name:HKYC
    Model Number:62568-57-4
    Place of Origin:China

    Healthy Peptides Bodybuilding Hormone Delta Sleep-inducing Peptide DSIP 2mg/vial

  • Buy cheap Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF product
    ...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1. Basic info. Product Name: MGF Synonyms: PEG MGF Sequence: ... more
    Brand Name:kafen
    Model Number:HGH-Eptifibatide
    Place of Origin:China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF

  • Buy cheap Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 product
    ...Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 Hexarelin Product Name Hexarelin Sequence Cas No. 140703-51-1 Molecular Formula C47H58N12O6 Molecular ... more
    Brand Name:Pharm
    Model Number:hannah@chembj.com
    Place of Origin:China

    Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1

Tell “injectable peptides bodybuilding” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0